Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnh2 Peptide - C-terminal region

Kcnh2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI326795, ERG1, LQT, Lqt2, M-erg, Merg1, merg1a, merg1b

UniProt

O35219

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnh2 Rabbit Polyclonal Antibody (orb575321) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038597

Preservative

Lyophilized powder

AA Sequence

RRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zfp579 activation kit by CRISPRa
GA207829 1 Kit

Mouse Zfp579 activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD11a Antibody[HI111]
E-AB-F1316G-01 20 Tests

PE/Cyanine5 Anti-Human CD11a Antibody[HI111]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD11a Antibody[HI111]
E-AB-F1316G-02 100 Tests

PE/Cyanine5 Anti-Human CD11a Antibody[HI111]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD11a Antibody[HI111]
E-AB-F1316G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD11a Antibody[HI111]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS645014 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
2-(4-Chlorophenoxy)acetic Acid
TRC-C374995-1G 1 g

2-(4-Chlorophenoxy)acetic Acid

Sign In for Pricing
View Details