Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH3 Peptide - N-terminal region

KCNH3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BEC1, ELK2, KIAA1282, Kv12.2

UniProt

Q9ULD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNH3 Rabbit Polyclonal Antibody (orb575407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036416

Preservative

Lyophilized powder

AA Sequence

AELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDISETKNRGGPDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Olfactory receptor 1J2 (OR1J2) ELISA Kit
GTR10369061 96 Well

Chicken Olfactory receptor 1J2 (OR1J2) ELISA Kit

Sign In for Pricing
View Details
FGF6 Polyclonal Antibody
MBS9128169-01 0.02 mL

FGF6 Polyclonal Antibody

Sign In for Pricing
View Details
FGF6 Polyclonal Antibody
MBS9128169-02 0.1 mL

FGF6 Polyclonal Antibody

Sign In for Pricing
View Details
FGF6 Polyclonal Antibody
MBS9128169-03 5x 0.1 mL

FGF6 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal INTS5 Antibody [PerCP]
NB100-60461PCP 0.1 mL

Rabbit Polyclonal INTS5 Antibody [PerCP]

Sign In for Pricing
View Details
6-Chloro-1,3-benzoxazol-2 (3H) -one
orb3029868-01 100 mg

6-Chloro-1,3-benzoxazol-2 (3H) -one

Sign In for Pricing
View Details