Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNH3 Peptide - N-terminal region

KCNH3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BEC1, ELK2, KIAA1282, Kv12.2

UniProt

Q9ULD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNH3 Rabbit Polyclonal Antibody (orb575407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036416

Preservative

Lyophilized powder

AA Sequence

AELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDISETKNRGGPDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coagulation Factor XI (F11) Antibody
abx215271-01 50 µg

Coagulation Factor XI (F11) Antibody

Sign In for Pricing
View Details
Coagulation Factor XI (F11) Antibody
abx215271-02 100 µg

Coagulation Factor XI (F11) Antibody

Sign In for Pricing
View Details
RRAS siRNA (Human)
orb1864058-01 15 nmol

RRAS siRNA (Human)

Sign In for Pricing
View Details
RRAS siRNA (Human)
orb1864058-02 30 nmol

RRAS siRNA (Human)

Sign In for Pricing
View Details
Ncoa2 sgRNA CRISPR Lentivector set (Mouse)
K3409001 3x 1.0 µg

Ncoa2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Human D-Amino Acid Oxidase (DAO) CLIA Kit
EKN50601 96 Tests

Human D-Amino Acid Oxidase (DAO) CLIA Kit

Sign In for Pricing
View Details