Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnip3 Peptide - middle region

Kcnip3 Peptide - middle region

Product Specifications

Product Name Alternative

4933407H12Rik, AI413860, Csen, DREAM, KChIP3, R74849

UniProt

Q9QXT8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnip3 Rabbit Polyclonal Antibody (orb574294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104801

Preservative

Lyophilized powder

AA Sequence

PMSMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD30/TNFRSF8 Antibody (rKi-1/779) [Alexa Fluor 594]
NBP2-54340AF594 0.1 mL

Mouse Monoclonal CD30/TNFRSF8 Antibody (rKi-1/779) [Alexa Fluor 594]

Sign In for Pricing
View Details
Rat Monoclonal Tryptase alpha/TPS1 Antibody (RM0355-10H34) [DyLight 405]
NBP2-11983V 0.1 mL

Rat Monoclonal Tryptase alpha/TPS1 Antibody (RM0355-10H34) [DyLight 405]

Sign In for Pricing
View Details
KIF9 Antibody - N-terminal region
ARP33966_P050-25UL 25 µL

KIF9 Antibody - N-terminal region

Sign In for Pricing
View Details
Chicken MBNL1 (Muscleblind-like protein 1) ELISA Kit
ELI-22764c 96 Tests

Chicken MBNL1 (Muscleblind-like protein 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-CDK8 IHC Antibody, Affinity Purified
IHC-00704 25 µg

Rabbit anti-CDK8 IHC Antibody, Affinity Purified

Sign In for Pricing
View Details
HER3 (phospho-Y1328) peptide
orb256810-01 1 mg

HER3 (phospho-Y1328) peptide

Sign In for Pricing
View Details