Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnip3 Peptide - middle region

Kcnip3 Peptide - middle region

Product Specifications

Product Name Alternative

4933407H12Rik, AI413860, Csen, DREAM, KChIP3, R74849

UniProt

Q9QXT8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnip3 Rabbit Polyclonal Antibody (orb574294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104801

Preservative

Lyophilized powder

AA Sequence

PMSMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Interleukin-18
CC067-005 5 µg

Recombinant Human Interleukin-18

Sign In for Pricing
View Details
6-Cyclohexylhexyl β-D-maltoside
DC05107-01 500 mg

6-Cyclohexylhexyl β-D-maltoside

Sign In for Pricing
View Details
6-Cyclohexylhexyl β-D-maltoside
DC05107-02 1000 mg

6-Cyclohexylhexyl β-D-maltoside

Sign In for Pricing
View Details
6-Cyclohexylhexyl β-D-maltoside
DC05107-03 2000 mg

6-Cyclohexylhexyl β-D-maltoside

Sign In for Pricing
View Details
6-Cyclohexylhexyl β-D-maltoside
DC05107-04 5000 mg

6-Cyclohexylhexyl β-D-maltoside

Sign In for Pricing
View Details
6-Cyclohexylhexyl β-D-maltoside
DC05107-05 10000 mg

6-Cyclohexylhexyl β-D-maltoside

Sign In for Pricing
View Details