Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnj3 Peptide - C-terminal region

Kcnj3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GIRK1, Kcnf3, Kir3.1, MGC124233, MGC124234

UniProt

P63250

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnj3 Rabbit Polyclonal Antibody (orb575366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032452

Preservative

Lyophilized powder

AA Sequence

QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Lymphoid Enhancer Binding Factor 1 (LEF1) ELISA Kit
abx556368 96 Tests

Mouse Lymphoid Enhancer Binding Factor 1 (LEF1) ELISA Kit

Sign In for Pricing
View Details
Cyclooctyne-O-amido-PEG4-VC-PAB-Gly-Gly-NH-O-CO-Exatecan
orb2283546-01 10 mg

Cyclooctyne-O-amido-PEG4-VC-PAB-Gly-Gly-NH-O-CO-Exatecan

Sign In for Pricing
View Details
Cyclooctyne-O-amido-PEG4-VC-PAB-Gly-Gly-NH-O-CO-Exatecan
orb2283546-02 50 mg

Cyclooctyne-O-amido-PEG4-VC-PAB-Gly-Gly-NH-O-CO-Exatecan

Sign In for Pricing
View Details
Recombinant Human GP1BB His Protein - (Dry Ice)
NBP3-21145-250ug 250 µg

Recombinant Human GP1BB His Protein - (Dry Ice)

Sign In for Pricing
View Details
Human SLC22A6 knockdown cell line
ABC-KD13939 1 Vial

Human SLC22A6 knockdown cell line

Sign In for Pricing
View Details