Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnj3 Peptide - C-terminal region

Kcnj3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GIRK1, Kcnf3, Kir3.1, MGC124233, MGC124234

UniProt

P63250

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnj3 Rabbit Polyclonal Antibody (orb575366) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032452

Preservative

Lyophilized powder

AA Sequence

QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIIF (GTF2F1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H3]
TA503380AM 100 µL

TFIIF (GTF2F1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H3]

Sign In for Pricing
View Details
ZFP408 Adenovirus (Mouse)
50960054 1.0 mL

ZFP408 Adenovirus (Mouse)

Sign In for Pricing
View Details
GGH Antibody
OACD03842-1ML 1 mL

GGH Antibody

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreE (ureE)
MBS1351582-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Urease accessory protein UreE (ureE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreE (ureE)
MBS1351582-02 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Urease accessory protein UreE (ureE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Urease accessory protein UreE (ureE)
MBS1351582-03 0.02 mg (Yeast)

Recombinant Synechococcus sp. Urease accessory protein UreE (ureE)

Sign In for Pricing
View Details