Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnq2 Peptide - middle region

Kcnq2 Peptide - middle region

Product Specifications

Product Name Alternative

HNSPC, KQT2, Nmf134

UniProt

E9PZW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Kcnq2 Rabbit Polyclonal Antibody (orb575383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006679

Preservative

Lyophilized powder

AA Sequence

VLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propargyl-O-C1-amido-PEG3-C2-NHS ester
MBS5800000 Inquire

Propargyl-O-C1-amido-PEG3-C2-NHS ester

Sign In for Pricing
View Details
Recombinant Mouse Prolactin Receptor/PRLR (C-Fc)
CM58-500ug 500 µg

Recombinant Mouse Prolactin Receptor/PRLR (C-Fc)

Sign In for Pricing
View Details
TSHB Antibody, HRP conjugated
CSB-PA11769B0Rb-01 50 µg

TSHB Antibody, HRP conjugated

Sign In for Pricing
View Details
TSHB Antibody, HRP conjugated
CSB-PA11769B0Rb-02 100 µg

TSHB Antibody, HRP conjugated

Sign In for Pricing
View Details
GH1 Rabbit Polyclonal Antibody (Fluoro594)
orb3116553 100 µg

GH1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Galactofucan polysaccharide
297069-01 50 mg

Galactofucan polysaccharide

Sign In for Pricing
View Details