Kcnq3 Peptide - middle region
Kcnq3 Peptide - middle region
Product Specifications
UniProt
Q8K3F6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Kcnq3 Rabbit Polyclonal Antibody (orb329812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_690887
Preservative
Lyophilized powder
AA Sequence
TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-I140115-25MG 25 mg
(S)-(+)-Ibuprofen 2-(Benzyloxy)propan-1-yl Ester
Sign In for Pricing
View Details 
![D-[1-13C]Xylulose (1M in Water)](https://cdn.genprice.uk/products/572/12203075/imageurl/trc-x750905-50mg.webp)
![FITC Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea82156/imageurl/ha720202f.webp)
HA720202F 100 µL
FITC Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)
Sign In for Pricing
View Details 
BNC680864-500 1x 500 µL
Glypican-3 (GPC3/863 + 1G12), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details