Kcnq3 Peptide - middle region
Kcnq3 Peptide - middle region
Product Specifications
UniProt
Q8K3F6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Kcnq3 Rabbit Polyclonal Antibody (orb329812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_690887
Preservative
Lyophilized powder
AA Sequence
TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882860-100 1x 100 µL
Mitochondria (Marker for Human Cells, Granular RCC's & Salivary Tumors) (MTC02/2860R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GM-08-15 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human IgM, 15nm
Sign In for Pricing
View Details 
LC424561 20 µg
Sodium Potassium ATPase (ATP1A1) (NM_000701) Human Over-expression Lysate
Sign In for Pricing
View Details 