Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNQ4 Peptide - middle region

KCNQ4 Peptide - middle region

Product Specifications

Product Name Alternative

DFNA2, KV7.4, DFNA2A

UniProt

P56696

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNQ4 Rabbit Polyclonal Antibody (orb329815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004691

Preservative

Lyophilized powder

AA Sequence

SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP155 Polyclonal Antibody
MBS9434152-01 0.05 mL

NUP155 Polyclonal Antibody

Sign In for Pricing
View Details
NUP155 Polyclonal Antibody
MBS9434152-02 0.1 mL

NUP155 Polyclonal Antibody

Sign In for Pricing
View Details
NUP155 Polyclonal Antibody
MBS9434152-03 5x 0.1 mL

NUP155 Polyclonal Antibody

Sign In for Pricing
View Details
MRS1177 50mg
A16871-50 50 mg

MRS1177 50mg

Sign In for Pricing
View Details
ZFP148 (G-rich Box-binding Protein Berf-1 EMBL AAK63003.1, Zinc Finger Protein 148)
495978 100 µL

ZFP148 (G-rich Box-binding Protein Berf-1 EMBL AAK63003.1, Zinc Finger Protein 148)

Sign In for Pricing
View Details
RPS6KB1 antibody
FNab11048 100 µg

RPS6KB1 antibody

Sign In for Pricing
View Details