Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNS1 Peptide - N-terminal region

KCNS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KV9.1

UniProt

A4K2N8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002242

Preservative

Lyophilized powder

AA Sequence

LCDDYDEAAREFYFDRHPGFFLSLLHFYRTGHLHVLDELCVFAFGQEADY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 540 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110T3-01 20 Tests

Elab Fluor® Violet 540 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110T3-02 100 Tests

Elab Fluor® Violet 540 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD8a Antibody[OKT-8]
E-AB-F1110T3-03 2x 100 Tests

Elab Fluor® Violet 540 Anti-Human CD8a Antibody[OKT-8]

Sign In for Pricing
View Details
PECAM1 Antibody
KC-6302-01 50 μL

PECAM1 Antibody

Sign In for Pricing
View Details
PECAM1 Antibody
KC-6302-02 100 µL

PECAM1 Antibody

Sign In for Pricing
View Details
PECAM1 Antibody
KC-6302-03 1 mL

PECAM1 Antibody

Sign In for Pricing
View Details