Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD17 Peptide - middle region

KCTD17 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ12242

UniProt

Q8N5Z5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD17 Rabbit Polyclonal Antibody (orb575457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078957

Preservative

Lyophilized powder

AA Sequence

YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human HOXB9 shRNA (UAS) - Lentiviral human HOXB9 shRNA (UAS, RFP) (100)
GTR15124344 1 Vial

Lentiviral human HOXB9 shRNA (UAS) - Lentiviral human HOXB9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RPS10 Recombinant Protein (Mouse)
RP169178 100 µg

RPS10 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
ARFGAP3 Protein Vector (Mouse) (pPM-C-His)
PV155621 500 ng

ARFGAP3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human CRISP1 sgRNA gene knockout kit - Lentiviral human CRISP1 sgRNA gene knockout kit (plasmid)
GTR15378407 1 Vial

Lentiviral human CRISP1 sgRNA gene knockout kit - Lentiviral human CRISP1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
DCAKD (NM_001128631) Human 3' UTR Clone
SC212444 10 µg

DCAKD (NM_001128631) Human 3' UTR Clone

Sign In for Pricing
View Details
KCNQ2 Blocking Peptide
33R-3916 0.1 mg

KCNQ2 Blocking Peptide

Sign In for Pricing
View Details