Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD17 Peptide - middle region

KCTD17 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ12242

UniProt

Q8N5Z5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD17 Rabbit Polyclonal Antibody (orb575457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078957

Preservative

Lyophilized powder

AA Sequence

YGSEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 Antibody
V2700-20UG 20 µg

CD46 Antibody

Sign In for Pricing
View Details
CID5721353
BA3075-50 50 mg

CID5721353

Sign In for Pricing
View Details
L3HYPDH Recombinant Protein Antigen
NBP2-31648PEP 0.1 mL

L3HYPDH Recombinant Protein Antigen

Sign In for Pricing
View Details
EIF5 (EIF-5, EIF-5A, Eukaryotic Translation Initiation Factor-5) (MaxLight 750)
MBS6446325-01 0.1 mL

EIF5 (EIF-5, EIF-5A, Eukaryotic Translation Initiation Factor-5) (MaxLight 750)

Sign In for Pricing
View Details
EIF5 (EIF-5, EIF-5A, Eukaryotic Translation Initiation Factor-5) (MaxLight 750)
MBS6446325-02 5x 0.1 mL

EIF5 (EIF-5, EIF-5A, Eukaryotic Translation Initiation Factor-5) (MaxLight 750)

Sign In for Pricing
View Details
EIF2AK2 (PKR) Rabbit Polyclonal Antibody (BF350)
orb1585443 100 µL

EIF2AK2 (PKR) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details