Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD21 Peptide - middle region

KCTD21 Peptide - middle region

Product Specifications

Product Name Alternative

KCASH2

UniProt

Q4G0X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD21 Rabbit Polyclonal Antibody (orb582345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025030

Preservative

Lyophilized powder

AA Sequence

VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPRSS15 Antibody
KC-3502-01 50 μL

TMPRSS15 Antibody

Sign In for Pricing
View Details
TMPRSS15 Antibody
KC-3502-02 100 µL

TMPRSS15 Antibody

Sign In for Pricing
View Details
TMPRSS15 Antibody
KC-3502-03 1 mL

TMPRSS15 Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8]
AM50260PU-S 100 µg

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody [Clone ID: K8.8]

Sign In for Pricing
View Details
HCV NS5B RdRp (77-86) Mouse Monoclonal Antibody [Clone ID: 7F12]
AM26125PU-N 100 µg

HCV NS5B RdRp (77-86) Mouse Monoclonal Antibody [Clone ID: 7F12]

Sign In for Pricing
View Details
RTKN (NM_001015055) Human Over-expression Lysate
LY423121 100 µg

RTKN (NM_001015055) Human Over-expression Lysate

Sign In for Pricing
View Details