Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD21 Peptide - middle region

KCTD21 Peptide - middle region

Product Specifications

Product Name Alternative

KCASH2

UniProt

Q4G0X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD21 Rabbit Polyclonal Antibody (orb582345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025030

Preservative

Lyophilized powder

AA Sequence

VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP22 Mouse Monoclonal Antibody [Clone ID: OTI5D1]
CF808964 100 µg

PMP22 Mouse Monoclonal Antibody [Clone ID: OTI5D1]

Sign In for Pricing
View Details
Rat Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit
RDR-HYAL1-Ra-01 96 Tests

Rat Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit

Sign In for Pricing
View Details
Rat Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit
RDR-HYAL1-Ra-02 48 Tests

Rat Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit

Sign In for Pricing
View Details
TFAP2E Human qPCR Primer Pair (NM_178548)
HP218873 200 Reactions

TFAP2E Human qPCR Primer Pair (NM_178548)

Sign In for Pricing
View Details
2-Amino-3,5-dibromobenzoic Acid
TRC-A610705-1G 1 g

2-Amino-3,5-dibromobenzoic Acid

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (N440K) (His Tag)
PKSV030450 100 µg

Recombinant SARS-CoV-2 Spike RBD (N440K) (His Tag)

Sign In for Pricing
View Details