Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD9 Peptide - middle region

KCTD9 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20038

UniProt

Q7L273

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD9 Rabbit Polyclonal Antibody (orb583401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060104

Preservative

Lyophilized powder

AA Sequence

AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLA/LP (h) -PR
sc-89108-PR 10 µM - 20 µL

SLA/LP (h) -PR

Sign In for Pricing
View Details
Syt4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6948105 3x 1.0 µg

Syt4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Metal tolerance protein 11 (MTP11)
orb2909660-01 20 µg

Recombinant Arabidopsis thaliana Metal tolerance protein 11 (MTP11)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Metal tolerance protein 11 (MTP11)
orb2909660-02 100 µg

Recombinant Arabidopsis thaliana Metal tolerance protein 11 (MTP11)

Sign In for Pricing
View Details
Officinalisinin I
MBS3843757-01 5 mg

Officinalisinin I

Sign In for Pricing
View Details
Officinalisinin I
MBS3843757-02 10 mg

Officinalisinin I

Sign In for Pricing
View Details