Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD9 Peptide - middle region

KCTD9 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20038

UniProt

Q7L273

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCTD9 Rabbit Polyclonal Antibody (orb583401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060104

Preservative

Lyophilized powder

AA Sequence

AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC13 Polyclonal Antibody
MBS2523500-01 0.02 mL

MUC13 Polyclonal Antibody

Sign In for Pricing
View Details
MUC13 Polyclonal Antibody
MBS2523500-02 0.06 mL

MUC13 Polyclonal Antibody

Sign In for Pricing
View Details
MUC13 Polyclonal Antibody
MBS2523500-03 0.12 mL

MUC13 Polyclonal Antibody

Sign In for Pricing
View Details
MUC13 Polyclonal Antibody
MBS2523500-04 0.2 mL

MUC13 Polyclonal Antibody

Sign In for Pricing
View Details
MUC13 Polyclonal Antibody
MBS2523500-05 5x 0.2 mL

MUC13 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Phyh Pre-designed siRNA Set A
SI110509A 1 Each

Mouse Phyh Pre-designed siRNA Set A

Sign In for Pricing
View Details