Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS2 Peptide - N-terminal region

KHDRBS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ38664, MGC26664, SLM-1, SLM1, bA535F17.1

UniProt

Q5VWX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHDRBS2 Rabbit Polyclonal Antibody (orb581948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689901

Preservative

Lyophilized powder

AA Sequence

EEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH9 Antibody
KC-587-01 50 μL

MYH9 Antibody

Sign In for Pricing
View Details
MYH9 Antibody
KC-587-02 100 µL

MYH9 Antibody

Sign In for Pricing
View Details
MYH9 Antibody
KC-587-03 1 mL

MYH9 Antibody

Sign In for Pricing
View Details
Phenol-OD
TRC-P318021-50MG 50 mg

Phenol-OD

Sign In for Pricing
View Details
CIBAR2 (NM_198491) Human Over-expression Lysate
LY403680 100 µg

CIBAR2 (NM_198491) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Gdf1 activation kit by CRISPRa
GA201579 1 Kit

Mouse Gdf1 activation kit by CRISPRa

Sign In for Pricing
View Details