Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS2 Peptide - N-terminal region

KHDRBS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ38664, MGC26664, SLM-1, SLM1, bA535F17.1

UniProt

Q5VWX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHDRBS2 Rabbit Polyclonal Antibody (orb581948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689901

Preservative

Lyophilized powder

AA Sequence

EEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QKI Recombinant Mouse monoclonal Antibody
HA601377 100 µL

QKI Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
1,3,2-Dioxathiolane 2,2-Dioxide
TRC-D486865-5G 5 g

1,3,2-Dioxathiolane 2,2-Dioxide

Sign In for Pricing
View Details
CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H1]
TA506055AM 100 µL

CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H1]

Sign In for Pricing
View Details
Atp5k (NM_007507) Mouse Tagged ORF Clone
MG200078 10 µg

Atp5k (NM_007507) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ICAM1 Mouse Monoclonal Antibody [Clone ID: 1H4]
AM03205AF-N 100 µg

ICAM1 Mouse Monoclonal Antibody [Clone ID: 1H4]

Sign In for Pricing
View Details
Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF740 conjugate, 0.1mg/mL
BNC742240-100 1x 100 µL

Geminin / DNA Replication Inhibitor (CPTC-GMMN-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details