PCLAF Peptide - N-terminal region
PCLAF Peptide - N-terminal region
Product Specifications
Product Name Alternative
L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15 (PAF)
UniProt
A6NNU5
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCLAF Rabbit Polyclonal Antibody (orb579631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001025160
Preservative
Lyophilized powder
AA Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKEHVLCNLI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PerCP/Cyanine5.5 Anti-Human CD274/PD-L1 Antibody[29E.2A3]](https://cdn.genprice.uk/products/763/68dd14a1061270361e7d098e/imageurl/e-ab-f1133j.webp)
E-AB-F1133J-01 20 Tests
PerCP/Cyanine5.5 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
Sign In for Pricing
View Details E-AB-F1133J-02 100 Tests
PerCP/Cyanine5.5 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
Sign In for Pricing
View Details E-AB-F1133J-03 2x 100 Tests
PerCP/Cyanine5.5 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
Sign In for Pricing
View Details 
