Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCLAF Peptide - N-terminal region

PCLAF Peptide - N-terminal region

Product Specifications

Product Name Alternative

L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15 (PAF)

UniProt

A6NNU5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCLAF Rabbit Polyclonal Antibody (orb579631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001025160

Preservative

Lyophilized powder

AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKEHVLCNLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FILIP1 activation kit by CRISPRa
GA109034 1 Kit

Human FILIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
CRYGD Human Gene Knockout Kit (CRISPR)
KN422889 1 Kit

CRYGD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF640R conjugate, 0.1mg/mL
BNC402497-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Synaptophysin Antibody
KC-1090-01 50 μL

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
KC-1090-02 100 µL

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
KC-1090-03 1 mL

Synaptophysin Antibody

Sign In for Pricing
View Details