Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUBCNL Peptide - middle region

RUBCNL Peptide - middle region

Product Specifications

Product Name Alternative

PACER, C13orf18, KIAA0226L

UniProt

Q96CS2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RUBCNL Rabbit Polyclonal Antibody (orb326434) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612452

Preservative

Lyophilized powder

AA Sequence

SKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB30 (6O9) Mouse Monoclonal antibody
E28PE3607 100 µL

RAB30 (6O9) Mouse Monoclonal antibody

Sign In for Pricing
View Details
1-Bromo-3-phenylpropane
TRC-B687060-10G 10 g

1-Bromo-3-phenylpropane

Sign In for Pricing
View Details
Anti-Drebrin 1 (DBN1) Monoclonal Antibody (Clone: DBN1/2880)
36-2157-100 100 µg

Anti-Drebrin 1 (DBN1) Monoclonal Antibody (Clone: DBN1/2880)

Sign In for Pricing
View Details
Anti-KLH | Keyhole limpet hemocyanin, Biotin-conjugated (40 µg)
AS99 001B 40 µg

Anti-KLH | Keyhole limpet hemocyanin, Biotin-conjugated (40 µg)

Sign In for Pricing
View Details
Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1) Antibody
abx412894 100 µg

Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1) Antibody

Sign In for Pricing
View Details
GSK3β Mouse mAb
E2251287 100 µL

GSK3β Mouse mAb

Sign In for Pricing
View Details