RUBCNL Peptide - middle region
RUBCNL Peptide - middle region
Product Specifications
Product Name Alternative
PACER, C13orf18, KIAA0226L
UniProt
Q96CS2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RUBCNL Rabbit Polyclonal Antibody (orb326434) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612452
Preservative
Lyophilized powder
AA Sequence
SKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10360923 96 Well
Porcine Cell death-inducing DFF45-like effector ELISA Kit
Sign In for Pricing
View Details 
MBS9020106-01 0.02 mg (E-Coli)
Recombinant Human Microtubule-associated protein tau (MAPT), partial
Sign In for Pricing
View Details MBS9020106-02 0.1 mg (E-Coli)
Recombinant Human Microtubule-associated protein tau (MAPT), partial
Sign In for Pricing
View Details MBS9020106-03 1 mg (E-Coli)
Recombinant Human Microtubule-associated protein tau (MAPT), partial
Sign In for Pricing
View Details