Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDC4 Peptide - middle region

KHDC4 Peptide - middle region

Product Specifications

Product Name Alternative

BLOM7, KIAA0907, SNORA80EHG

UniProt

Q7Z7F0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHDC4 Rabbit Polyclonal Antibody (orb582640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055764

Preservative

Lyophilized powder

AA Sequence

ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enoxolone EP Impurity A
RM-E141501-01 10 mg

Enoxolone EP Impurity A

Sign In for Pricing
View Details
Enoxolone EP Impurity A
RM-E141501-02 25 mg

Enoxolone EP Impurity A

Sign In for Pricing
View Details
Enoxolone EP Impurity A
RM-E141501-03 50 mg

Enoxolone EP Impurity A

Sign In for Pricing
View Details
Enoxolone EP Impurity A
RM-E141501-04 100 mg

Enoxolone EP Impurity A

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)
MBS2039165-01 0.1 mL

FITC-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)
MBS2039165-02 0.2 mL

FITC-Linked Polyclonal Antibody to Glucosidase Alpha, Acid (GaA)

Sign In for Pricing
View Details