Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDC4 Peptide - middle region

KHDC4 Peptide - middle region

Product Specifications

Product Name Alternative

BLOM7, KIAA0907, SNORA80EHG

UniProt

Q7Z7F0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHDC4 Rabbit Polyclonal Antibody (orb582640) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055764

Preservative

Lyophilized powder

AA Sequence

ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphatidylcholine Antibody (IgM) Human ELISA Kit
F8287 96 Tests

Phosphatidylcholine Antibody (IgM) Human ELISA Kit

Sign In for Pricing
View Details
Canine salmonella typhi antibody,St-Ab ELISA KIT
JOT-EKD0024Ca 96 wells

Canine salmonella typhi antibody,St-Ab ELISA KIT

Sign In for Pricing
View Details
MCSF/CSF1 Rabbit Polyclonal Antibody (Fluoro594)
orb3076817 100 µg

MCSF/CSF1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
DSG1 Antibody
orb2672394-01 50 µL

DSG1 Antibody

Sign In for Pricing
View Details
DSG1 Antibody
orb2672394-02 100 µL

DSG1 Antibody

Sign In for Pricing
View Details
DSG1 Antibody
orb2672394-03 200 µL

DSG1 Antibody

Sign In for Pricing
View Details