KIAA0999 Peptide - middle region
KIAA0999 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ12240, KIAA0999, L19, QSK, SIK-3
UniProt
Q9Y2K2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIAA0999 Rabbit Polyclonal Antibody (orb582226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079440
Preservative
Lyophilized powder
AA Sequence
LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681812-500 1x 500 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941825-500 1x 500 µL
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details