KIAA1549 Peptide - C-terminal region
KIAA1549 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ11731, FLJ38703, FLJ40644, KIAA1549
UniProt
Q9HCM3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIAA1549 Rabbit Polyclonal Antibody (orb580217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
AAH38232
Preservative
Lyophilized powder
AA Sequence
QVPRTSGREPSAPSGNLPHRGLQGPGLGYPTSSTEDLQPGHSSASLIKAI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681073-100 1x 100 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400977-500 1x 500 µL
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680843-500 1x 500 µL
CD106 / VCAM1 (VCAM1/843), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details