Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEAK7 Peptide - N-terminal region

MEAK7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TLDC1, mEAK-7, KIAA1609

UniProt

Q6P9B6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEAK7 Rabbit Polyclonal Antibody (orb583588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065998

Preservative

Lyophilized powder

AA Sequence

MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOR1AIP1 Antibody
KC-30771-01 50 μL

TOR1AIP1 Antibody

Sign In for Pricing
View Details
TOR1AIP1 Antibody
KC-30771-02 100 µL

TOR1AIP1 Antibody

Sign In for Pricing
View Details
TOR1AIP1 Antibody
KC-30771-03 1 mL

TOR1AIP1 Antibody

Sign In for Pricing
View Details
BZW2 (NM_001159767) Human Recombinant Protein
TP328886L 1 mg

BZW2 (NM_001159767) Human Recombinant Protein

Sign In for Pricing
View Details
SPPL3 (N-term) Rabbit Polyclonal Antibody
AP13339PU-N 400 µL

SPPL3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Octadecylamine-d37
TRC-O239712-25MG 25 mg

Octadecylamine-d37

Sign In for Pricing
View Details