Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEAK7 Peptide - N-terminal region

MEAK7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TLDC1, mEAK-7, KIAA1609

UniProt

Q6P9B6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEAK7 Rabbit Polyclonal Antibody (orb583588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065998

Preservative

Lyophilized powder

AA Sequence

MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon
CB612621 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
APC Anti-Human CD9 Antibody[HI9a]
E-AB-F1086E-01 20 Tests

APC Anti-Human CD9 Antibody[HI9a]

Sign In for Pricing
View Details
APC Anti-Human CD9 Antibody[HI9a]
E-AB-F1086E-02 100 Tests

APC Anti-Human CD9 Antibody[HI9a]

Sign In for Pricing
View Details
APC Anti-Human CD9 Antibody[HI9a]
E-AB-F1086E-03 2x 100 Tests

APC Anti-Human CD9 Antibody[HI9a]

Sign In for Pricing
View Details
8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), CF568 conjugate, 0.1mg/mL
BNC682251-500 1x 500 µL

8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPC1 Mouse Monoclonal Antibody [Clone ID: OTI3G9]
CF812434 100 µg

GPC1 Mouse Monoclonal Antibody [Clone ID: OTI3G9]

Sign In for Pricing
View Details