KIAA1704 Peptide - middle region
KIAA1704 Peptide - middle region
Product Specifications
Product Name Alternative
AD029, LSR7, RP11-245H20.2, bA245H20.2, KIAA1704
UniProt
Q8IXQ4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIAA1704 Rabbit Polyclonal Antibody (orb583503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061029
Preservative
Lyophilized powder
AA Sequence
KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H1830-91E-AP 100 µL
Heat Shock Protein 70 (HSP70, Heat Shock 70kD Protein 1A, HSPA1, HSPA1A, Heat Shock 70kDa Protein 1B, HSPA1B, HSP70-1B, Heat Shock 70kD Protein 1, HSP70.1, HSP70-1, Heat Shock 70kD Protein 2, HSP70.2, HSP70-2, FLJ54328) (AP) discontinued
Sign In for Pricing
View Details 
MBS7033086-01 0.02 mg
Recombinant Rhizobium meliloti Undecaprenyl-diphosphatase (uppP)
Sign In for Pricing
View Details MBS7033086-02 0.1 mg
Recombinant Rhizobium meliloti Undecaprenyl-diphosphatase (uppP)
Sign In for Pricing
View Details MBS7033086-03 5x 0.1 mg
Recombinant Rhizobium meliloti Undecaprenyl-diphosphatase (uppP)
Sign In for Pricing
View Details VAng-2502Lsx-500g 500 µg
Recombinant ASFV War-105 Protein (aa 1-80)
Sign In for Pricing
View Details