Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1704 Peptide - middle region

KIAA1704 Peptide - middle region

Product Specifications

Product Name Alternative

AD029, LSR7, RP11-245H20.2, bA245H20.2, KIAA1704

UniProt

Q8IXQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIAA1704 Rabbit Polyclonal Antibody (orb583503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061029

Preservative

Lyophilized powder

AA Sequence

KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD64 (FCGR1A) Mouse Monoclonal Antibody [Clone ID: LBI1D8]
AMM13799VCF 100 µg

CD64 (FCGR1A) Mouse Monoclonal Antibody [Clone ID: LBI1D8]

Sign In for Pricing
View Details
Lentiviral human GALNT2 shRNA (UAS) - Lentiviral human GALNT2 shRNA (UAS, RFP) (25)
GTR15092951 1 Vial

Lentiviral human GALNT2 shRNA (UAS) - Lentiviral human GALNT2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
SPTBN1 Polyclonal Antibody, Biotin Conjugated
A68946-050 50 μL

SPTBN1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
FEZF1 Antibody
orb423016-01 50 µg

FEZF1 Antibody

Sign In for Pricing
View Details
FEZF1 Antibody
orb423016-02 100 µg

FEZF1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Rectum
CB521427 1 Block

Frozen Tissue Blocks, Rectum

Sign In for Pricing
View Details