KIF25 Peptide - N-terminal region
KIF25 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KNSL3, MGC163361
UniProt
Q9UIL4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIF25 Rabbit Polyclonal Antibody (orb574894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005346
Preservative
Lyophilized powder
AA Sequence
YNVCVMAYGQTGSGKSYTMLGRHSDDGPVLPLDPQSDLGIIPRVAEELFR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740204-100 1x 100 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471037-500 1x 500 µL
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 