Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF7 Peptide - C-terminal region

KIF7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC120653, MGC138476, MGC138478, UNQ340, ACLS, HLS2, JBTS12

UniProt

Q2M1P5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF7 Rabbit Polyclonal Antibody (orb326405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940927

Preservative

Lyophilized powder

AA Sequence

EKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SA2 Rabbit Polyclonal Antibody (PerCP)
orb2390784 100 µL

SA2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
M-PEG-thiol (MW 2000)
HY-140706-01 100 mg

M-PEG-thiol (MW 2000)

Sign In for Pricing
View Details
M-PEG-thiol (MW 2000)
HY-140706-02 250 mg

M-PEG-thiol (MW 2000)

Sign In for Pricing
View Details
M-PEG-thiol (MW 2000)
HY-140706-03 5 g

M-PEG-thiol (MW 2000)

Sign In for Pricing
View Details
M-PEG-thiol (MW 2000)
HY-140706-04 10 g

M-PEG-thiol (MW 2000)

Sign In for Pricing
View Details
DNAJA1 Rabbit mAb
RDSA66000 100 µL

DNAJA1 Rabbit mAb

Sign In for Pricing
View Details