Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF7 Peptide - C-terminal region

KIF7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC120653, MGC138476, MGC138478, UNQ340, ACLS, HLS2, JBTS12

UniProt

Q2M1P5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIF7 Rabbit Polyclonal Antibody (orb326405) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940927

Preservative

Lyophilized powder

AA Sequence

EKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCA7 Double Nickase Plasmid (m)
sc-424270-NIC 20 µg

ABCA7 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
STT3B Polyclonal Antibody
E915574 100 µL

STT3B Polyclonal Antibody

Sign In for Pricing
View Details
Canine Apolipoprotein E ELISA kit
GTR10454840 96 Well

Canine Apolipoprotein E ELISA kit

Sign In for Pricing
View Details
AOX1 ELISA Kit (Bovine) (OKCD09447)
OKCD09447 96 Well

AOX1 ELISA Kit (Bovine) (OKCD09447)

Sign In for Pricing
View Details
Gm15023 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4328503 1.0 µg DNA

Gm15023 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Chicken Ankyrin repeat domain containing protein 56 (ANKRD56) ELISA kit
GTR10458710 96 Well

Chicken Ankyrin repeat domain containing protein 56 (ANKRD56) ELISA kit

Sign In for Pricing
View Details