KIFAP3 Peptide - middle region
KIFAP3 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ22818, KAP3, SMAP, Smg-GDS, dJ190I16.1, KAP-3
UniProt
Q92845
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIFAP3 Rabbit Polyclonal Antibody (orb582644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055785
Preservative
Lyophilized powder
AA Sequence
WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
133602-APC 100 µL
SNAP 25 (SNAP25, Synaptosomal-Associated protein 25, SNAP-25, Synaptosomal-Associated 25kD Protein, SUP, Super Protein, SNAP, Synaptosomal-Associated Protein, 25kDa) (APC)
Sign In for Pricing
View Details 
BPTL-265 1 Unit
Automatic Vapor Pressure Tester (Reid Method) BPTL-265
Sign In for Pricing
View Details MBS1299009-01 0.02 mg (E-Coli)
Recombinant Pyrobaculum aerophilum Putative ribonuclease VapC3 (vapC3)
Sign In for Pricing
View Details MBS1299009-02 0.1 mg (E-Coli)
Recombinant Pyrobaculum aerophilum Putative ribonuclease VapC3 (vapC3)
Sign In for Pricing
View Details MBS1299009-03 0.02 mg (Yeast)
Recombinant Pyrobaculum aerophilum Putative ribonuclease VapC3 (vapC3)
Sign In for Pricing
View Details