Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIFAP3 Peptide - middle region

KIFAP3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ22818, KAP3, SMAP, Smg-GDS, dJ190I16.1, KAP-3

UniProt

Q92845

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIFAP3 Rabbit Polyclonal Antibody (orb582645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055785

Preservative

Lyophilized powder

AA Sequence

WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Cervix
CS501763 5x 5 µm

Frozen Tissue Sections, Cervix

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF640R conjugate, 0.1mg/mL
BNC402720-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidine Kinase 1 (TK1) Rabbit Monoclonal Antibody [Clone ID: R05-9G6]
TA421514 100 µL

Thymidine Kinase 1 (TK1) Rabbit Monoclonal Antibody [Clone ID: R05-9G6]

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), 1mg/mL
BNUM0009-50 1x 50 µL

MART-1 / Melan-A (M2-7C10), 1mg/mL

Sign In for Pricing
View Details
Recombinant PKN1 Antibody
RC-4606-01 50 μL

Recombinant PKN1 Antibody

Sign In for Pricing
View Details
Recombinant PKN1 Antibody
RC-4606-02 100 µL

Recombinant PKN1 Antibody

Sign In for Pricing
View Details