Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIFAP3 Peptide - middle region

KIFAP3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ22818, KAP3, SMAP, Smg-GDS, dJ190I16.1, KAP-3

UniProt

Q92845

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIFAP3 Rabbit Polyclonal Antibody (orb582645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055785

Preservative

Lyophilized powder

AA Sequence

WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4-Acetylcytosine
TRC-N633020-500MG 500 mg

N4-Acetylcytosine

Sign In for Pricing
View Details
Capsazepine
TRC-C175710-5MG 5 mg

Capsazepine

Sign In for Pricing
View Details
SPATA16 (NM_031955) Human Recombinant Protein
TP760135 50 µg

SPATA16 (NM_031955) Human Recombinant Protein

Sign In for Pricing
View Details
Human SPEM3 activation kit by CRISPRa
GA119792 1 Kit

Human SPEM3 activation kit by CRISPRa

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF640R conjugate, 0.1mg/mL
BNC401239-500 1x 500 µL

Napsin-A (NAPSA/1239), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), Biotin conjugate, 0.1mg/mL
BNCB1993-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details