Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf2 Peptide - N-terminal region

Klf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Lklf

UniProt

Q60843

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klf2 Rabbit Polyclonal Antibody (orb576143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032478

Preservative

Lyophilized powder

AA Sequence

MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCBP2-AS1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV736054 1.0 µg DNA

NCBP2-AS1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
α-actinin-3 siRNA (h)
sc-43099 10 µM

α-actinin-3 siRNA (h)

Sign In for Pricing
View Details
PRPF19, NT (PRPF19, NMP200, PRP19, SNEV, Pre-mRNA-processing factor 19, Nuclear matrix protein 200, PRP19/PSO4 homolog, Senescence evasion factor) (Biotin) discontinued
040488-Biotin 200 µL

PRPF19, NT (PRPF19, NMP200, PRP19, SNEV, Pre-mRNA-processing factor 19, Nuclear matrix protein 200, PRP19/PSO4 homolog, Senescence evasion factor) (Biotin) discontinued

Sign In for Pricing
View Details
TRNAK7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2496205 3x 1.0 µg

TRNAK7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RNF165 Rabbit pAb, PE-Cy5.5 conjugated
orb2851819 100 µL

RNF165 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Recombinant E. coli RNA polymerase sigma factor RpoH (rpoH)
RPC27193-01 20 µg

Recombinant E. coli RNA polymerase sigma factor RpoH (rpoH)

Sign In for Pricing
View Details