Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf3 Peptide - C-terminal region

Klf3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bklf, Tef-2

UniProt

D4A4V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klf3 Rabbit Polyclonal Antibody (orb577032) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099212

Preservative

Lyophilized powder

AA Sequence

WEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cubilin (CUBN) (NM_001081) Human Over-expression Lysate
LC421147 20 µg

Cubilin (CUBN) (NM_001081) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS635734 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
(±)-Mevalonolactone-4,4,5,5,6,6,6-d7
TRC-M339026-2.5MG 2.5 mg

(±)-Mevalonolactone-4,4,5,5,6,6,6-d7

Sign In for Pricing
View Details
Glycine-13C2
TRC-G615998-50MG 50 mg

Glycine-13C2

Sign In for Pricing
View Details
Basic Green 4 (Technical Grade)
TRC-B127633-50G 50 g

Basic Green 4 (Technical Grade)

Sign In for Pricing
View Details
C14orf148 (NOXRED1) Human Gene Knockout Kit (CRISPR)
KN418665 1 Kit

C14orf148 (NOXRED1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details