KLHDC3 Peptide - N-terminal region
KLHDC3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PEAS, RP1-20C7.3, dJ20C7.3, hPEAS
UniProt
Q9BQ90
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLHDC3 Rabbit Polyclonal Antibody (orb581719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_476502
Preservative
Lyophilized powder
AA Sequence
MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881832-500 1x 500 µL
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1832), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681858-100 1x 100 µL
CD43 (T-Cell Marker) (rSPN/1094), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details