Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klhdc9 Peptide - middle region

Klhdc9 Peptide - middle region

Product Specifications

Product Name Alternative

1190002J23Rik, AA087357, ESTM31

UniProt

Q3USL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klhdc9 Rabbit Polyclonal Antibody (orb581449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028211

Preservative

Lyophilized powder

AA Sequence

HHSCSVVGPFAVLFGGETLTRARDTICNDLYIYDTRKSPPLWFHFPSTDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Integrin alpha V/ITGAV Antibody Picoband®, FITC Conjugate
A01561-2-FITC 100 µg/Vial

Anti-Integrin alpha V/ITGAV Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Cimpuciclib (tosylate)
HY-112243A-01 5 mg

Cimpuciclib (tosylate)

Sign In for Pricing
View Details
Cimpuciclib (tosylate)
HY-112243A-02 10 mg

Cimpuciclib (tosylate)

Sign In for Pricing
View Details
Cimpuciclib (tosylate)
HY-112243A-03 25 mg

Cimpuciclib (tosylate)

Sign In for Pricing
View Details
Cimpuciclib (tosylate)
HY-112243A-04 50 mg

Cimpuciclib (tosylate)

Sign In for Pricing
View Details
Cimpuciclib (tosylate)
HY-112243A-05 100 mg

Cimpuciclib (tosylate)

Sign In for Pricing
View Details