Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klhdc9 Peptide - middle region

Klhdc9 Peptide - middle region

Product Specifications

Product Name Alternative

1190002J23Rik, AA087357, ESTM31

UniProt

Q3USL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klhdc9 Rabbit Polyclonal Antibody (orb581449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028211

Preservative

Lyophilized powder

AA Sequence

HHSCSVVGPFAVLFGGETLTRARDTICNDLYIYDTRKSPPLWFHFPSTDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBOX5 Rabbit Polyclonal Antibody
orb3071228-01 30 µL

UBOX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBOX5 Rabbit Polyclonal Antibody
orb3071228-02 50 µL

UBOX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBOX5 Rabbit Polyclonal Antibody
orb3071228-03 100 µL

UBOX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBOX5 Rabbit Polyclonal Antibody
orb3071228-04 200 µL

UBOX5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chicken Abhydrolase domain-containing protein 14A (ABHD14A) ELISA Kit
MBS7215068-01 48 Well

Chicken Abhydrolase domain-containing protein 14A (ABHD14A) ELISA Kit

Sign In for Pricing
View Details
Chicken Abhydrolase domain-containing protein 14A (ABHD14A) ELISA Kit
MBS7215068-02 96 Well

Chicken Abhydrolase domain-containing protein 14A (ABHD14A) ELISA Kit

Sign In for Pricing
View Details