Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klhl1 Peptide - C-terminal region

Klhl1 Peptide - C-terminal region

Product Specifications

UniProt

D4A9J8

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klhl1 Rabbit Polyclonal Antibody (orb575100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099524

Preservative

Lyophilized powder

AA Sequence

DMQRRCGDLSMLLAFIRLPLLPPQILADLENHALFKNDLECQKLILEAMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S) -1- (2,5-Dimethoxyphenyl) ethan-1-ol
GGA71310-01 50 mg

(1S) -1- (2,5-Dimethoxyphenyl) ethan-1-ol

Sign In for Pricing
View Details
(1S) -1- (2,5-Dimethoxyphenyl) ethan-1-ol
GGA71310-02 0.5 g

(1S) -1- (2,5-Dimethoxyphenyl) ethan-1-ol

Sign In for Pricing
View Details
GZMB siRNA (Human)
CRH2037-01 15 nmol

GZMB siRNA (Human)

Sign In for Pricing
View Details
GZMB siRNA (Human)
CRH2037-02 30 nmol

GZMB siRNA (Human)

Sign In for Pricing
View Details
HIV TAT specific factor 1 Recombinant Antibody
bsm-62353R-TR 20 µL

HIV TAT specific factor 1 Recombinant Antibody

Sign In for Pricing
View Details
Recombinant Hahella chejuensis Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)
MBS1484234-01 0.02 mg (E-Coli)

Recombinant Hahella chejuensis Putative cobalt-precorrin-6A synthase [deacetylating] (cbiD)

Sign In for Pricing
View Details