Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klhl1 Peptide - C-terminal region

Klhl1 Peptide - C-terminal region

Product Specifications

UniProt

D4A9J8

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klhl1 Rabbit Polyclonal Antibody (orb575100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099524

Preservative

Lyophilized powder

AA Sequence

DMQRRCGDLSMLLAFIRLPLLPPQILADLENHALFKNDLECQKLILEAMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GP6/Glycoprotein-6 Antibody (Glenzocimab)
F1702-50 50 mg

Anti-GP6/Glycoprotein-6 Antibody (Glenzocimab)

Sign In for Pricing
View Details
Bromo-PEG10-t-butyl ester
orb3132493-01 10 mg

Bromo-PEG10-t-butyl ester

Sign In for Pricing
View Details
Bromo-PEG10-t-butyl ester
orb3132493-02 50 mg

Bromo-PEG10-t-butyl ester

Sign In for Pricing
View Details
BCL2L10 Rabbit Polyclonal Antibody (Cy7)
orb1043130 100 µL

BCL2L10 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Tumor markers CRASH
7B6 100 μg

Tumor markers CRASH

Sign In for Pricing
View Details
GRAP discontinued
510002 100 µg

GRAP discontinued

Sign In for Pricing
View Details