Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL22 Peptide - N-terminal region

KLHL22 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KELCHL

UniProt

Q53GT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL22 Rabbit Polyclonal Antibody (orb584751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116164

Preservative

Lyophilized powder

AA Sequence

ILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CRTAC1 Antibody
A10445-1 100 µL

Anti-CRTAC1 Antibody

Sign In for Pricing
View Details
Mouse Jagged-1 (NP_038850.1) VersaClone cDNA
RDC3084 10 µg

Mouse Jagged-1 (NP_038850.1) VersaClone cDNA

Sign In for Pricing
View Details
NFKBID Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
31780061 1.0 µg DNA

NFKBID Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Antifreeze Polypeptide 6 (winter flounder)
orb1941698-01 1 mg

Antifreeze Polypeptide 6 (winter flounder)

Sign In for Pricing
View Details
Antifreeze Polypeptide 6 (winter flounder)
orb1941698-02 5 mg

Antifreeze Polypeptide 6 (winter flounder)

Sign In for Pricing
View Details
Antifreeze Polypeptide 6 (winter flounder)
orb1941698-03 10 mg

Antifreeze Polypeptide 6 (winter flounder)

Sign In for Pricing
View Details