Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL22 Peptide - N-terminal region

KLHL22 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KELCHL

UniProt

Q53GT1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL22 Rabbit Polyclonal Antibody (orb584751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116164

Preservative

Lyophilized powder

AA Sequence

ILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP1A2 Antibody-N-terminal region
ARP96897_P050 100 µL

ATP1A2 Antibody-N-terminal region

Sign In for Pricing
View Details
FAM163A (G-12)
sc-393821 200 µg/mL

FAM163A (G-12)

Sign In for Pricing
View Details
CD127 Rabbit Monoclonal Antibody
E56G3469 100 µL

CD127 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabeprazole Sulfide N-Oxide
TRC-R070535-10MG 10 mg

Rabeprazole Sulfide N-Oxide

Sign In for Pricing
View Details
CDK6 Antibody
orb1178586 100 µg

CDK6 Antibody

Sign In for Pricing
View Details
Human USP35 Pre-designed siRNA Set A
SI017933A 1 Each

Human USP35 Pre-designed siRNA Set A

Sign In for Pricing
View Details