Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK13 Peptide - middle region

KLK13 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZP586J1923, KLK-L4, KLKL4

UniProt

Q9UKR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLK13 Rabbit Polyclonal Antibody (orb582702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056411

Preservative

Lyophilized powder

AA Sequence

VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPU1 rabbit pAb
E28PN4223 100 µL

MPU1 rabbit pAb

Sign In for Pricing
View Details
Rat WS Superior Cervical Ganglion Frozen Sections*
RF-237-WS 10 Slides

Rat WS Superior Cervical Ganglion Frozen Sections*

Sign In for Pricing
View Details
Canine IFN-gamma Quantikine ELISA Kit
CAIF00 96 Tests

Canine IFN-gamma Quantikine ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-372-3p inhibitor
HY-RI00824-01 5 nmol

Hsa-miR-372-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-372-3p inhibitor
HY-RI00824-02 20 nmol

Hsa-miR-372-3p inhibitor

Sign In for Pricing
View Details
1- (Difluoromethyl) -3,5-difluorobenzene
PC1023072 1 g

1- (Difluoromethyl) -3,5-difluorobenzene

Sign In for Pricing
View Details