KLK13 Peptide - middle region
KLK13 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZP586J1923, KLK-L4, KLKL4
UniProt
Q9UKR3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLK13 Rabbit Polyclonal Antibody (orb582702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056411
Preservative
Lyophilized powder
AA Sequence
VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
131660-APC 100 µL
PPIL2 (Peptidyl-prolyl Cis-trans Isomerase-like 2, Cyclophilin-60, Cyclophilin-like Protein Cyp-60, Rotamase PPIL2) (APC)
Sign In for Pricing
View Details 
![Mouse Monoclonal NCAM-1/CD56 Antibody (1006411) [DyLight 680]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FAB24084Y 0.1 mL
Mouse Monoclonal NCAM-1/CD56 Antibody (1006411) [DyLight 680]
Sign In for Pricing
View Details 
abx533946 96 Tests
Mouse Myotubularin-related protein 11 (MTMR11) ELISA Kit
Sign In for Pricing
View Details