Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klkb1 Peptide - C-terminal region

Klkb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Klk3, Kalp1, KALP15, MGC108748, Klkb1

UniProt

P14272

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klkb1 Rabbit Polyclonal Antibody (orb579536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036857

Preservative

Lyophilized powder

AA Sequence

GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitropyridine N-Oxide
TRC-N519920-1G 1 g

4-Nitropyridine N-Oxide

Sign In for Pricing
View Details
Mouse Ewsr1 activation kit by CRISPRa
GA201321 1 Kit

Mouse Ewsr1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)
PDEO100025-01 20 µg

Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)
PDEO100025-02 100 µg

Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)
PDEO100025-03 500 µg

Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)
PDEO100025-04 1 mg

Recombinant chiken IGF1/IGF‑I/IGF-1 protein (His tag)

Sign In for Pricing
View Details